PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18607 to PF07510 (DUF1524)

VIMSS18607 has 404 amino acids

Query:       DUF1524  [M=139]
Accession:   PF07510.11
Description: Protein of unknown function (DUF1524)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.3e-23   67.9   4.8    9.6e-23   66.8   4.8    1.6  1  VIMSS18607  


Domain annotation for each sequence (and alignments):
>> VIMSS18607  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   66.8   4.8   9.6e-23   9.6e-23       5     139 .]     251     392 ..     248     392 .. 0.91

  Alignments for each domain:
  == domain 1  score: 66.8 bits;  conditional E-value: 9.6e-23
     DUF1524   5 eefrrallnaklysssrkklryilakelesalreedeeegeakklt...iEHilPqslaekw.....egagqedeekreelvndlgNLtlltkslNssl 95 
                 +++  a+++ +++ s++ + +yi+++++ +++   d ++  ++k++    EHi P +l +++     ++ g+ed+++ e+++++ gNL+ l+kslN+++
  VIMSS18607 251 NDIGLAFWQSVNNASNSSCFHYIFFEKNCQEMGLADLKKLIPRKQFsqeKEHIIPINLLKQEsnnkiRDLGFEDKKDLEDYIDTYGNLISLEKSLNRKA 349
                 567778888899999999***********99997777666666777778***********889************************************ PP

     DUF1524  96 snkpfleKrdlykksslrlnrklaekdewdeeaiearqeaLakv 139
                 s+k+  +K++ yk+s++  nr++ + ++++++a+ +r+e++ ++
  VIMSS18607 350 SDKDLYGKDEIYKSSEIPFNRRF-DTKNFNKKALVKRNEEMREW 392
                 ***********************.799**************886 PP



Or compare VIMSS18607 to CDD or PaperBLAST