PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS27031 to PF07510 (DUF1524)

VIMSS27031 has 567 amino acids

Query:       DUF1524  [M=139]
Accession:   PF07510.11
Description: Protein of unknown function (DUF1524)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.5e-19   55.3   1.2    3.5e-19   55.3   1.2    2.4  2  VIMSS27031  


Domain annotation for each sequence (and alignments):
>> VIMSS27031  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   0.7     0.054     0.054      58      92 ..      90     116 ..      26     176 .. 0.51
   2 !   55.3   1.2   3.5e-19   3.5e-19       4     138 ..     413     554 ..     410     555 .. 0.90

  Alignments for each domain:
  == domain 1  score: -0.4 bits;  conditional E-value: 0.054
     DUF1524  58 slaekwegagqedeekreelvndlgNLtlltkslN 92 
                 +++e++        ++ ++++++ g L l   s+N
  VIMSS27031  90 QYEEDK--------RETRKYLYQKGELKLEVASQN 116
                 333322........444444444455444444444 PP

  == domain 2  score: 55.3 bits;  conditional E-value: 3.5e-19
     DUF1524   4 deefrrallnaklysssrkklryilakelesalreedeeegeakklt...iEHilPqslaekw.....egagqedeekreelvndlgNLtlltkslNss 94 
                  ++++ a+++ +++  ++ + +yi+++++ +++   d ++  + k++    EHi P +l + +     ++ g+ed ++ + ++++ gNL+ l+k+lN +
  VIMSS27031 413 RNDIELAFRQSVNEAFNSSCFHYIFFEKNCQEMGLADLKKLIPGKQFsqeKEHIIPINLLDLDneieiQKLGFEDRKDLRAYIYTYGNLISLEKPLNIK 511
                 578999************************99996655555555555556***********5559********************************** PP

     DUF1524  95 lsnkpfleKrdlykksslrlnrklaekdewdeeaiearqeaLak 138
                  ++k+  eK++ yk+s++  nr+++  + ++++++  r++++ +
  VIMSS27031 512 GKDKDLYEKDEIYKSSEIPFNRRFN-VKGFNKKVLITRNDEMQE 554
                 ************************5.889***********9976 PP



Or compare VIMSS27031 to CDD or PaperBLAST