PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS27810 to PF07510 (DUF1524)

VIMSS27810 has 200 amino acids

Query:       DUF1524  [M=139]
Accession:   PF07510.11
Description: Protein of unknown function (DUF1524)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    8.6e-27   79.9   7.1    1.2e-26   79.5   7.1    1.3  1  VIMSS27810  


Domain annotation for each sequence (and alignments):
>> VIMSS27810  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.5   7.1   1.2e-26   1.2e-26      11     137 ..      47     170 ..      15     172 .. 0.87

  Alignments for each domain:
  == domain 1  score: 79.5 bits;  conditional E-value: 1.2e-26
     DUF1524  11 llnaklysssrkklryilakelesalreedeeegeakkltiEHilPqslaekwegagqedeekreelvndlgNLtlltkslNsslsnkpfleKrdlykk 109
                  +n++ ++++ k l y+l+ e e + + e++ + + ++++iEHilPq++++ + +a++++  k   +v+ lgNL+l+ k  Nsslsnkpf+eKr++y k
  VIMSS27810  47 KKNTEKWYKWGKTLNYLLY-EYELYHNPETTLNFDGSIESIEHILPQKPDQGY-SAKEKNWAKNPHVVHALGNLLLIPKNANSSLSNKPFDEKRKEYLK 143
                 4555666667779999999.77755555555566677888*************.99999999999********************************86 PP

     DUF1524 110 sslrlnrklaekdewdeeaiearqeaLa 137
                  s+  ++++a++++++ ++i++r+e+L+
  VIMSS27810 144 GSY-SEKEVAKNASFGITEIQKRSEKLL 170
                 665.9*********************98 PP



Or compare VIMSS27810 to CDD or PaperBLAST