PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS45872 to PF07510 (DUF1524)

VIMSS45872 has 971 amino acids

Query:       DUF1524  [M=139]
Accession:   PF07510.11
Description: Protein of unknown function (DUF1524)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      1e-24   73.2   9.8      1e-24   73.2   9.8    5.4  6  VIMSS45872  


Domain annotation for each sequence (and alignments):
>> VIMSS45872  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?  -11.2  12.3         1         1      19     106 ..      64     145 ..      48     209 .. 0.53
   2 ?  -14.9  14.9         1         1      77      77 ..     206     206 ..     124     270 .. 0.59
   3 ?   -7.1   6.5         1         1      72      92 ..     482     499 ..     448     566 .. 0.60
   4 ?   -3.5   0.4      0.48      0.48     114     124 ..     611     621 ..     584     646 .. 0.58
   5 !   73.2   9.8     1e-24     1e-24       3     138 ..     771     911 ..     769     912 .. 0.93
   6 !    3.0   0.1    0.0048    0.0048     110     137 ..     929     956 ..     913     958 .. 0.82

  Alignments for each domain:
  == domain 1  score: -11.2 bits;  conditional E-value: 1
     DUF1524  19 ssrkklryilakelesalreedeeegeakkltiEHilPqslaekwegagqedeekreelvnd.lgNLtlltkslNsslsnkpfleKrdl 106
                 ss + +r++++ ++  ++++++++++ ++++  + i+  + +++   ++  ++   + +vn+ l NL l +  +N      + ++K++ 
  VIMSS45872  64 SSYELIRVLYYLQIIVDSDKNKTINTYKNDTLKDYIFTFNVSDNT--EKSINKHITNVFVNKfLRNLDLNDFFQN-----ETIDQKNKD 145
                 443444444444444455555555555455557777777777766..4444444444444542244444444444.....333333332 PP

  == domain 2  score: -14.9 bits;  conditional E-value: 1
     DUF1524  77 l 77 
                 l
  VIMSS45872 206 L 206
                 1 PP

  == domain 3  score: -7.1 bits;  conditional E-value: 1
     DUF1524  72 ekreelvndlgNLtlltkslN 92 
                      + n + NL++l+   N
  VIMSS45872 482 FANALFNNLILNLVILK---N 499
                 44444444567777666...3 PP

  == domain 4  score: -3.5 bits;  conditional E-value: 0.48
     DUF1524 114 lnrklaekdew 124
                 +n+k++ k++w
  VIMSS45872 611 INKKFTLKNNW 621
                 33333333333 PP

  == domain 5  score: 73.2 bits;  conditional E-value: 1e-24
     DUF1524   3 rdeefrrallnaklysssrkklryilakelesalreedeeegeakklt..................iEHilPqslaekwegagqedeekreelvndlgN 83 
                 + +++++ ++++ ++++s+ +l+y++++e++ +++ +d++ ++ +k+t                  iEH+++qsl+++           +++++n++gN
  VIMSS45872 771 EIKNIKNFYNKMLDEKVSDIHLAYLIRFETYLTFFLDDTQINK-NKDTkvffyppsnadnekadltIEHMYSQSLKDER----------FNIVKNNIGN 858
                 678999************99***************88666666.4555588**************************88..........********** PP

     DUF1524  84 LtlltkslNsslsnkpfleKrdlykksslrlnrklaekdewdeeaiearqeaLak 138
                 L+ ltk++Ns+l+nk+f++K+++yk+  +++n +l+  +  +ee+i++  ++++k
  VIMSS45872 859 LIPLTKEYNSALNNKEFKDKKQRYKNAPIIQNLWLY--KGLNEEQITKLYNEFTK 911
                 ***********************************7..*************9988 PP

  == domain 6  score: 3.0 bits;  conditional E-value: 0.0048
     DUF1524 110 sslrlnrklaekdewdeeaiearqeaLa 137
                 ++  ++ kl++k+e ++e+i++r++a+a
  VIMSS45872 929 KEALMSLKLSDKEELQPEQIKKRTQAIA 956
                 456789999***************9986 PP



Or compare VIMSS45872 to CDD or PaperBLAST