PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060370.1 to PF08213 (DUF1713)

NP_060370.1 has 199 amino acids

Query:       DUF1713  [M=33]
Accession:   PF08213.11
Description: Mitochondrial domain of unknown function (DUF1713)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.8e-17   48.3  14.7    3.8e-17   48.3  14.7    2.0  2  NP_060370.1  


Domain annotation for each sequence (and alignments):
>> NP_060370.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   48.3  14.7   3.8e-17   3.8e-17       1      31 [.     127     157 ..     127     159 .. 0.96
   2 ?   -3.0   2.9       0.4       0.4      20      27 ..     163     170 ..     161     175 .. 0.58

  Alignments for each domain:
  == domain 1  score: 48.3 bits;  conditional E-value: 3.8e-17
      DUF1713   1 adSVlrKRrkKMkKHKyKKlrKrtRflrrkl 31 
                  +++Vl++Rr+KM++HKy+Kl K+tRflrrk+
  NP_060370.1 127 CKNVLKIRRRKMNHHKYRKLVKKTRFLRRKV 157
                  89****************************7 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.4
      DUF1713  20 lrKrtRfl 27 
                  +rK  +f+
  NP_060370.1 163 RRKQIKFE 170
                  45555554 PP



Or compare NP_060370.1 to CDD or PaperBLAST