PaperBLAST – Find papers about a protein or its homologs

 

Align NP_079614.1 to PF08213 (DUF1713)

NP_079614.1 has 200 amino acids

Query:       DUF1713  [M=33]
Accession:   PF08213.11
Description: Mitochondrial domain of unknown function (DUF1713)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.5e-17   48.9  16.3    2.5e-17   48.9  16.3    1.9  2  NP_079614.1  


Domain annotation for each sequence (and alignments):
>> NP_079614.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   48.9  16.3   2.5e-17   2.5e-17       1      32 [.     128     159 ..     128     160 .. 0.96
   2 ?   -4.1   2.9      0.93      0.93       6      11 ..     164     169 ..     162     176 .. 0.58

  Alignments for each domain:
  == domain 1  score: 48.9 bits;  conditional E-value: 2.5e-17
      DUF1713   1 adSVlrKRrkKMkKHKyKKlrKrtRflrrklg 32 
                  +++Vl++Rr+KM++HKy+Kl KrtRflrrk++
  NP_079614.1 128 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVR 159
                  89****************************86 PP

  == domain 2  score: -4.1 bits;  conditional E-value: 0.93
      DUF1713   6 rKRrkK 11 
                  +K++ K
  NP_079614.1 164 KKKQIK 169
                  555555 PP



Or compare NP_079614.1 to CDD or PaperBLAST