PaperBLAST – Find papers about a protein or its homologs

 

Align Q9DCJ7 to PF08213 (COX24_C)

Q9DCJ7 has 200 amino acids

Query:       COX24_C  [M=33]
Accession:   PF08213.15
Description: Mitochondrial mRNA-processing protein COX24, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.7e-17   47.5  16.3    6.7e-17   47.5  16.3    1.8  2  Q9DCJ7    


Domain annotation for each sequence (and alignments):
>> Q9DCJ7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.5  16.3   6.7e-17   6.7e-17       1      32 [.     128     159 ..     128     160 .. 0.96
   2 ?   -4.6   2.7         1         1       7      20 ..     165     167 ..     162     176 .. 0.44

  Alignments for each domain:
  == domain 1  score: 47.5 bits;  conditional E-value: 6.7e-17
  COX24_C   1 adSVlrKRrkKMkKHKyKKlrKrtRalrrrlg 32 
              +++Vl++Rr+KM++HKy+Kl KrtR+lrr+++
   Q9DCJ7 128 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVR 159
              89****************************86 PP

  == domain 2  score: -4.6 bits;  conditional E-value: 1
  COX24_C   7 KRrkKMkKHKyKKl 20 
              K           K 
   Q9DCJ7 165 K-----------KQ 167
              2...........22 PP



Or compare Q9DCJ7 to CDD or PaperBLAST