PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9P7H5 to PF08213 (DUF1713)

SwissProt::Q9P7H5 has 175 amino acids

Query:       DUF1713  [M=33]
Accession:   PF08213.11
Description: Mitochondrial domain of unknown function (DUF1713)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.6e-16   46.3  21.5    2.2e-16   45.9  21.5    1.2  1  SwissProt::Q9P7H5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9P7H5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.9  21.5   2.2e-16   2.2e-16       2      33 .]     144     175 .]     143     175 .] 0.97

  Alignments for each domain:
  == domain 1  score: 45.9 bits;  conditional E-value: 2.2e-16
            DUF1713   2 dSVlrKRrkKMkKHKyKKlrKrtRflrrklgk 33 
                        +SV+rKR++KM+KHK+KK+++r+R+lr++lgk
  SwissProt::Q9P7H5 144 TSVKRKRKLKMNKHKFKKRLRRQRALRKRLGK 175
                        7******************************8 PP



Or compare SwissProt::Q9P7H5 to CDD or PaperBLAST