PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001006158.1 to PF08217 (DUF1712)

NP_001006158.1 has 476 amino acids

Query:       DUF1712  [M=609]
Accession:   PF08217.11
Description: Fungal domain of unknown function (DUF1712)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.4e-106  343.4   7.0    1.1e-96  310.7   0.5    2.1  2  NP_001006158.1  


Domain annotation for each sequence (and alignments):
>> NP_001006158.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  310.7   0.5   1.1e-96   1.1e-96       1     468 [.      22     407 ..      22     418 .. 0.97
   2 !   42.0   1.1   2.4e-15   2.4e-15     526     609 .]     396     473 ..     393     473 .. 0.88

  Alignments for each domain:
  == domain 1  score: 310.7 bits;  conditional E-value: 1.1e-96
         DUF1712   1 ivvFnpskgqkEgdelkklLlyhpfteeeislneklskiGlieaiitFtetFsnedtcevieteketiifyevEpdfwlvLvvenpkeqknkeik 95 
                     ++++np+ g+kEg+e+kk+L+yhp+   e++ nek++++Gl+eai++Ft+tFs+ ++ ++++t+k++++f+e+E++fw+v+vv+np  +k k++k
  NP_001006158.1  22 FFIYNPKLGPKEGEEEKKILFYHPN---EVEKNEKIRNVGLCEAIVQFTRTFSPTKPAKSLHTQKNRQFFHEPEENFWMVMVVRNPIIEKHKDGK 113
                     89***********************...9**********************************************************889999** PP

         DUF1712  96 eqi...........ysavLkqcYqfFklfnGsfsslae..erekLtdllneflvkfwqdlkllpetdllkslgtvlwhdfykvaelqsedksWea 177
                      ++           ys+vL+qcY+++klfnG+f + +e   ++ L+++l++f+++++q+l+ l+++dll+ + ++                    
  NP_001006158.1 114 PVYeyqeeelldkvYSSVLQQCYSMYKLFNGTFLKAMEdgGVKVLKERLEKFFHRYLQTLH-LQSCDLLDVFCGI-------------------- 187
                     **************************************999********************.9*********999.................... PP

         DUF1712 178 iikqnllLdkenyLgikDvlvYhlPknekktkeYglirnfeseleslkelSnwLyhdhlvygtlsshdLagnvhlkeqeedeeletdsstrvlyn 272
                        ++++Ldk++yL+i+                 ++i+++e++l+ +k ++++Ly+d+l++++l+++d                     +r+ly+
  NP_001006158.1 188 ---SFFPLDKMTYLKIQ-----------------SFINRMEESLNIVK-YTAFLYNDQLIWSGLEQDD---------------------MRILYK 240
                     ...**************.................**************.*******************.....................****** PP

         DUF1712 273 vtlpilfaydaisevgsltginnslslvmnytpk...gnvrssssensnskakldrqeedrfgfliSplakvllpesyklkklqlkfntdekkey 364
                     +++++lf++++  e++     ++s+  ++++ +    g++ +++ + ++ +ak++             ++k+++             ntd++ e+
  NP_001006158.1 241 YLTTSLFPRHMEPELAG----RDSPIRAEMPGNLqhyGRFLTGPLNLNDPEAKCR-------------FPKIFV-------------NTDDTYEE 305
                     ***************99....9999999988888888****************99.............99****.............******** PP

         DUF1712 365 lnllfykakdvltvllldpafekiweqdylkeLdaklleqlsllaesieeelskeknsekkkksesfaYlifdkktkkirssiprkktslkksee 459
                     l+l++yka++ + v+++++a +  ++ +++++Ld+ + +ql++la++i+e+++ +k+ + ++k+ +f++++f++++++ +s+i+++kt + +  +
  NP_001006158.1 306 LHLIVYKAMS-AAVCFMIDA-SIPPTLEFCRKLDSIVGPQLTVLASDICEQYNINKRISGAEKEPQFKFIYFNHMNLAEKSTIHMRKTPSVSLAS 398
                     **********.99*****98.666*********************************************************************** PP

         DUF1712 460 lsrntLklv 468
                     ++++ +k++
  NP_001006158.1 399 VHPDLMKIL 407
                     *******87 PP

  == domain 2  score: 42.0 bits;  conditional E-value: 2.4e-15
         DUF1712 526 Lldlnvellrilttlkrs..lkd.iqeErllklnngwlvyikennrelylilknwfqdnktkkasstlldlfeslgrdvtrwleeif 609
                     L  ++ +l++il+ ++      d  +e  +++++++w+v +k+++rely+il+++         +++l++++e++++++ +++++if
  NP_001006158.1 396 LASVHPDLMKILGDINSDfsRVDeDEEIIVKAMSDYWVVGKKSDQRELYVILNQK---------NANLIEVNEEVKKLCATQFNNIF 473
                     778899********9987654442444469*************************.........********************997 PP



Or compare NP_001006158.1 to CDD or PaperBLAST