PaperBLAST – Find papers about a protein or its homologs

 

Align NP_056437.4 to PF08217 (DUF1712)

NP_056437.4 has 482 amino acids

Query:       DUF1712  [M=609]
Accession:   PF08217.11
Description: Fungal domain of unknown function (DUF1712)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.4e-109  353.3   5.8    1.1e-99  320.6   0.3    2.1  2  NP_056437.4  


Domain annotation for each sequence (and alignments):
>> NP_056437.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  320.6   0.3   1.1e-99   1.1e-99       1     468 [.      27     413 ..      27     427 .. 0.98
   2 !   41.0   1.2   4.9e-15   4.9e-15     526     609 .]     402     479 ..     401     479 .. 0.88

  Alignments for each domain:
  == domain 1  score: 320.6 bits;  conditional E-value: 1.1e-99
      DUF1712   1 ivvFnpskgqkEgdelkklLlyhpfteeeislneklskiGlieaiitFtetFsnedtcevieteketiifyevEpdfwlvLvvenpk.eqknkeikeq 97 
                  ++++np++g++Eg+e++k+L+yhp+   e++ nek++++Gl+eai++Ft+tFs++++ ++++t+k++++f e+E++fw+v+vv+np  e+++k++k +
  NP_056437.4  27 FFIYNPRFGPREGQEENKILFYHPN---EVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIiEKQSKDGKPV 121
                  89***********************...9********************************************************************* PP

      DUF1712  98 i...........ysavLkqcYqfFklfnGsfsslae..erekLtdllneflvkfwqdlkllpetdllkslgtvlwhdfykvaelqsedksWeaiikqn 182
                  i           ys+vL+qcY+++klfnG+f + +e   ++ L+++l++f+++++q+l+ l+++dll+++g++                       ++
  NP_056437.4 122 IeyqeeelldkvYSSVLRQCYSMYKLFNGTFLKAMEdgGVKLLKERLEKFFHRYLQTLH-LQSCDLLDIFGGI-----------------------SF 195
                  ************************************999********************.9************.......................** PP

      DUF1712 183 llLdkenyLgikDvlvYhlPknekktkeYglirnfeseleslkelSnwLyhdhlvygtlsshdLagnvhlkeqeedeeletdsstrvlynvtlpilfa 280
                  ++Ldk++yL+i+                 ++i+++e++l+ +k ++++Ly+d+l++++l+++d                     +r+ly++++++lf+
  NP_056437.4 196 FPLDKMTYLKIQ-----------------SFINRMEESLNIVK-YTAFLYNDQLIWSGLEQDD---------------------MRILYKYLTTSLFP 254
                  ************.................**************.*******************.....................************** PP

      DUF1712 281 ydaisevgsltginnslslvmnytpk...gnvrssssensnskakldrqeedrfgfliSplakvllpesyklkklqlkfntdekkeylnllfykakdv 375
                  +++  e++     ++s+  ++++ +    g++ +++ + ++ +ak++             ++k+++             ntd++ e+l+l++yka++ 
  NP_056437.4 255 RHIEPELAG----RDSPIRAEMPGNLqhyGRFLTGPLNLNDPDAKCR-------------FPKIFV-------------NTDDTYEELHLIVYKAMS- 321
                  *******99....9999999988888888****************99.............99****.............******************. PP

      DUF1712 376 ltvllldpafekiweqdylkeLdaklleqlsllaesieeelskeknsekkkksesfaYlifdkktkkirssiprkktslkkseelsrntLklv 468
                  + v+++++a +++++ d++++Ld+ + +ql++la++i+e+++ +k+++ ++k+ +f++++f++++++ +s+++++kt + + ++++++ +k++
  NP_056437.4 322 AAVCFMIDA-SVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL 413
                  999**9998.999******************************************************************************87 PP

  == domain 2  score: 41.0 bits;  conditional E-value: 4.9e-15
      DUF1712 526 Lldlnvellrilttlkrs..lkdiqeE.rllklnngwlvyikennrelylilknwfqdnktkkasstlldlfeslgrdvtrwleeif 609
                  L  ++ +l++il+ ++      d +eE  +++++++w+v +k+++rely+il+++         +++l++++e++++++ +++++if
  NP_056437.4 402 LTSVHPDLMKILGDINSDftRVDEDEEiIVKAMSDYWVVGKKSDRRELYVILNQK---------NANLIEVNEEVKKLCATQFNNIF 479
                  6778999********998754444444269*************************.........********************997 PP



Or compare NP_056437.4 to CDD or PaperBLAST