PaperBLAST – Find papers about a protein or its homologs

 

Align NP_178206.1 to PF08217 (DUF1712)

NP_178206.1 has 497 amino acids

Query:       DUF1712  [M=609]
Accession:   PF08217.11
Description: Fungal domain of unknown function (DUF1712)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.6e-107  346.5   0.0   9.4e-107  343.9   0.0    1.8  1  NP_178206.1  


Domain annotation for each sequence (and alignments):
>> NP_178206.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  343.9   0.0  9.4e-107  9.4e-107       1     609 []      15     494 ..      15     494 .. 0.98

  Alignments for each domain:
  == domain 1  score: 343.9 bits;  conditional E-value: 9.4e-107
      DUF1712   1 ivvFnpskgqkEgdelkklLlyhpfteeeislneklskiGlieaiitFtetFsnedtcevieteketiifyevEpdfwlvLvvenpkeqknkeikeqi 98 
                  ++vF+ ++gq+Eg+el+k+L+++p+   +++++++ls+iGl+e++itFt+ Fs+e++cevie+e+++++fye+Epd+w+v++ve     knkei++++
  NP_178206.1  15 LCVFDLRRGQHEGQELDKILFFYPP---DLTFSTQLSVIGLSEGLITFTRLFSPEAACEVIEAERHSHVFYEAEPDIWMVMIVE-----KNKEIEAVW 104
                  69***********************...********************************************************.....********* PP

      DUF1712  99 ....ysavLkqcYqfFklfnGsfsslae.......erekLtdllneflvkfw..qdlkllpetdllkslgtvlwhdfykvaelqsedksWeaiikqnl 183
                      +++vLk+++++F +f+Gs+++l+e        r++L+ +++++l++ +  ++ +l++++d+lk++gtv                       q+l
  NP_178206.1 105 ridaLRRVLKEVHSLFVMFQGSIRALLEkeptgglVRSHLYPFITDYLNDLFvgKKQQLPSFRDTLKERGTV-----------------------QML 179
                  *************************************************9988*******************.......................*** PP

      DUF1712 184 lLdkenyLgikDvlvYhlPknekktkeYglirnfeseleslkelSnwLyhdhlvygtlsshdLagnvhlkeqeedeeletdsstrvlynvtlpilfay 281
                  +L+++ +L+++                 +l+++++s+ ++++++S++L+hd lv++tls++d                     t  l+++ +++l+++
  NP_178206.1 180 TLARDAALEVQ-----------------SLVGVLDSCAGTVRCHSVILFHDLLVSTTLSPDD---------------------TVDLFAFSVMRLTTN 239
                  ***********.................**********************************.....................*************** PP

      DUF1712 282 daisevgsltginnslslvmnytpk......gnvrssssensnskakldrqee........drfgfliSplakvllpesyklkklqlkf.ntdekkey 364
                  +++s ++s+++++++ +++++++++      g+  + +s n++s+ ++ r+ +        d+f+     +++++++++       +++  +++++e+
  NP_178206.1 240 ALSSGTSSWSYLRKGSGSPQISSRSttvpplGSGGTLPSGNGSSTGRVIRPLQhdkwskgkDGFL-----VTDIWGLDA-------TPTiLIQKTQES 325
                  ******************************************************99999988888.....999**9777.......466699****** PP

      DUF1712 365 lnllfykakdvltvllldpafekiweqdylkeLdaklleqlsllaesieeelskeknsekkkksesfaYlifdkktkkirssiprkktslkkseelsr 462
                  ++ll+y++k+ lt++ll+p  + ++++  ++ ++++++e++s+ + ++ee+lsk++++e+++++++++Yl++d++++++r+s+p+k+++l+k++ l+ 
  NP_178206.1 326 FYLLTYQYKS-LTLVLLVPIAAIVNGELDISFVKQQVIENASTKILKVEEKLSKGWGGENAYHVSGYRYLLVDNDMEVSRASPPGKVATLAKESLLAL 422
                  **********.*************************************************************************************** PP

      DUF1712 463 ntLklvvnGidqllqatssvasntnlgsnskevtaeksrskndktekkdeeilnfldklseekLldlnvellrilttlkrslkdiqeErllklnngwl 560
                  n+L+                          +ev++ek+rsk    ++kd+ei+                                    ++++nn+w+
  NP_178206.1 423 NKLR--------------------------EEVDTEKNRSK----QEKDMEIC------------------------------------IRAKNNTWV 454
                  ****..........................**********6....99******....................................********* PP

      DUF1712 561 vyikennrelylilknwfqdnktkkasstlldlfeslgrdvtrwleeif 609
                  +++ ++++ely++l+++         s+tlld+++s++r+++r+++++f
  NP_178206.1 455 IARLNRGKELYMALEKA---------SETLLDATDSVQRFSNRYCSGAF 494
                  *****************.........*******************9986 PP



Or compare NP_178206.1 to CDD or PaperBLAST