PaperBLAST – Find papers about a protein or its homologs

 

Align NP_808350.1 to PF08217 (DUF1712)

NP_808350.1 has 480 amino acids

Query:       DUF1712  [M=609]
Accession:   PF08217.11
Description: Fungal domain of unknown function (DUF1712)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   5.8e-108  347.9   6.2    3.1e-98  315.8   0.5    2.1  2  NP_808350.1  


Domain annotation for each sequence (and alignments):
>> NP_808350.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  315.8   0.5   3.1e-98   3.1e-98       1     468 [.      25     411 ..      25     425 .. 0.97
   2 !   41.6   0.8   3.3e-15   3.3e-15     526     609 .]     400     477 ..     398     477 .. 0.89

  Alignments for each domain:
  == domain 1  score: 315.8 bits;  conditional E-value: 3.1e-98
      DUF1712   1 ivvFnpskgqkEgdelkklLlyhpfteeeislneklskiGlieaiitFtetFsnedtcevieteketiifyevEpdfwlvLvvenpk.eqknkeikeq 97 
                  ++++np++g++Eg+e++k+L+yhp+   e++ nek++++Gl+eai++Ft+tFs++++ ++++t+k++++f e+E++fw+v+vv+np  e+++k++k++
  NP_808350.1  25 FFIYNPRFGPREGEEENKILFYHPN---EVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIiEKQSKDGKAV 119
                  89***********************...9********************************************************************9 PP

      DUF1712  98 i...........ysavLkqcYqfFklfnGsfsslae..erekLtdllneflvkfwqdlkllpetdllkslgtvlwhdfykvaelqsedksWeaiikqn 182
                  +           ys+vL+qcY+++klfnG+f + +e   ++ L+++l++f+++++q+l+ l+++dll+++g++                       ++
  NP_808350.1 120 VeyqeeelldkvYSSVLQQCYSMYKLFNGTFLKAMEdgGVKLLKERLEKFFHRYLQTLH-LQSCDLLDIFGGI-----------------------SF 193
                  9***********************************999********************.9************.......................** PP

      DUF1712 183 llLdkenyLgikDvlvYhlPknekktkeYglirnfeseleslkelSnwLyhdhlvygtlsshdLagnvhlkeqeedeeletdsstrvlynvtlpilfa 280
                  ++Ldk++yL+i+                 ++i+++e++l+ +k ++++Ly+d+l++++l+++d                     +r+ly++++++lf+
  NP_808350.1 194 FPLDKMTYLKIQ-----------------SFINRMEESLSVVK-YTAFLYNDQLIWSGLEQDD---------------------MRILYKYLTTSLFP 252
                  ************.................**************.*******************.....................************** PP

      DUF1712 281 ydaisevgsltginnslslvmnytpk...gnvrssssensnskakldrqeedrfgfliSplakvllpesyklkklqlkfntdekkeylnllfykakdv 375
                  +++  e++     ++s+  ++++ +    g++ +++ + ++ +ak++             ++k+++             ntd++ e+l+l++yka++ 
  NP_808350.1 253 RHIEPELAG----RDSPVRAEMPGNLqhyGRFLTGPLNLNDPEAKCR-------------FPKIFV-------------NTDDTYEELHLIVYKAMS- 319
                  *******99....9999999988888888****************99.............99****.............******************. PP

      DUF1712 376 ltvllldpafekiweqdylkeLdaklleqlsllaesieeelskeknsekkkksesfaYlifdkktkkirssiprkktslkkseelsrntLklv 468
                  + v+++++a+ +  + d++++Ld+ + +ql++la++i+e+++ +k+ + ++k+ +f++++f++++++ +s+i+++kt + + ++++++ +k++
  NP_808350.1 320 AAVCFMIDASTP-LTLDFCRRLDSIVGPQLTVLASDICEQFNINKRISGSEKEPQFKFIYFNHMNLAEKSTIHMRKTPSVSLTSVHPDLMKIL 411
                  9*******9776.89****************************************************************************87 PP

  == domain 2  score: 41.6 bits;  conditional E-value: 3.3e-15
      DUF1712 526 Lldlnvellrilttlkrs..lkdiqeE.rllklnngwlvyikennrelylilknwfqdnktkkasstlldlfeslgrdvtrwleeif 609
                  L  ++ +l++il+ ++      d +eE  +++++++w+v +k+++rely+il ++         +++l++++e++++++ +++++if
  NP_808350.1 400 LTSVHPDLMKILGDINSDftRADEDEEiIVKAMSDYWVVGKKSDQRELYVILSQK---------NANLIEVNEEVKKLCATQFNNIF 477
                  778899*********998844445555258*************************.........********************997 PP



Or compare NP_808350.1 to CDD or PaperBLAST