VIMSS6577338 has 281 amino acids
Query: DUF1746 [M=116] Accession: PF08508.14 Description: Fungal domain of unknown function (DUF1746) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-36 111.1 4.4 2.9e-36 110.6 4.4 1.2 1 VIMSS6577338 Domain annotation for each sequence (and alignments): >> VIMSS6577338 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.6 4.4 2.9e-36 2.9e-36 1 116 [] 18 129 .. 18 129 .. 0.97 Alignments for each domain: == domain 1 score: 110.6 bits; conditional E-value: 2.9e-36 DUF1746 1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesftellpaekpllvaillsnllclllhllfslpsageatrgylhggliidFiGqkapt 97 sLd+l+y+ ++ +Y++D ++l+lll+++vqls+ltpkp s+ ++lp l++ +ll +l++l+++++f+lp+age+ +gyl+gg ii+FiG+k + VIMSS6577338 18 SLDMLCYAIIAQQYFQDPTVLLLLLKVFVQLSYLTPKPFSQLNALP----LFYPLLLNFLISLMVRMFFNLPTAGESLDGYLYGGSIINFIGEKNES 110 79*************************************8766655....*********************************************** PP DUF1746 98 srlellllDllilllqllm 116 sr+++++ Dl++++lq++m VIMSS6577338 111 SRIDFITSDLVLFCLQIFM 129 *****************98 PP
Or compare VIMSS6577338 to CDD or PaperBLAST