PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10092933 to PF08551 (DUF1751)

VIMSS10092933 has 304 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    3.7e-35  106.8   6.1    7.9e-35  105.7   6.1    1.6  1  VIMSS10092933  


Domain annotation for each sequence (and alignments):
>> VIMSS10092933  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.7   6.1   7.9e-35   7.9e-35       1      99 []      44     142 ..      44     142 .. 0.99

  Alignments for each domain:
  == domain 1  score: 105.7 bits;  conditional E-value: 7.9e-35
        DUF1751   1 PgallpypwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvlltlllylvtkseelllvpisGlagilagflva 96 
                    P++++p++w+l+t++++e++v++v++s+++ll++gk+lE++Wgs+E+lkFi+vvn++t l+v++++++ly++t+ e++l++p++G++g+lag+lv 
  VIMSS10092933  44 PARTIPFAWNLITSGYFELSVYGVVFSTVSLLFMGKFLEPVWGSTEFLKFIFVVNFLTYLCVFVTAIALYYITRLEVYLYMPFAGFHGVLAGLLVG 139
                    999********************************************************************************************* PP

        DUF1751  97 lkQ 99 
                    +kQ
  VIMSS10092933 140 IKQ 142
                    **9 PP



Or compare VIMSS10092933 to CDD or PaperBLAST