PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10159188 to PF08551 (DUF1751)

VIMSS10159188 has 296 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      1e-09   25.2   1.4      1e-09   25.2   1.4    2.1  3  VIMSS10159188  


Domain annotation for each sequence (and alignments):
>> VIMSS10159188  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.5   0.1      0.93      0.93      72      73 ..      95      96 ..      83     112 .. 0.46
   2 !   25.2   1.4     1e-09     1e-09       7      90 ..     126     206 ..     117     214 .. 0.83
   3 ?   -1.1   0.2      0.16      0.16       7      27 ..     227     247 ..     220     266 .. 0.60

  Alignments for each domain:
  == domain 1  score: -3.5 bits;  conditional E-value: 0.93
        DUF1751 72 vt 73
                   +t
  VIMSS10159188 95 LT 96
                   11 PP

  == domain 2  score: 25.2 bits;  conditional E-value: 1e-09
        DUF1751   7 ypwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvlltlllylvtkseelllvpisGlagil 90 
                    y+wt +t+ f    +++++ + + l+++g ++Er+ gs+ ++  +lv +++++l  v   +ll+  + s +   v  sG++  +
  VIMSS10159188 126 YVWTWVTSIFAHGGFYHIVGNSIVLFFFGPLVERYVGSRKFAALFLVSGMLAGLAQVGSSMLLSPGSLSAV---VGASGAIMAV 206
                    9******************************************************9999998875544444...4455555555 PP

  == domain 3  score: -1.1 bits;  conditional E-value: 0.16
        DUF1751   7 ypwtlltasfveqnvwkvlvs 27 
                     p  l+t +f  ++v+ ++ +
  VIMSS10159188 227 VPLWLFTLGFAGISVFFFVSQ 247
                    555566666666665555443 PP



Or compare VIMSS10159188 to CDD or PaperBLAST