PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10322802 to PF08551 (DUF1751)

VIMSS10322802 has 319 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.9e-10   25.6   1.6    7.9e-10   25.6   1.6    2.1  3  VIMSS10322802  


Domain annotation for each sequence (and alignments):
>> VIMSS10322802  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.0      0.29      0.29      66      97 ..      97     127 ..      92     129 .. 0.59
   2 !   25.6   1.6   7.9e-10   7.9e-10       6      67 ..     132     193 ..     123     195 .. 0.93
   3 ?   -2.5   0.3      0.43      0.43      57      68 ..     223     234 ..     212     254 .. 0.58

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.29
        DUF1751  66 tlllylvtkseelllvpisGlagilagflval 97 
                     l+l+ +t   + llv   G a+++ +++v  
  VIMSS10322802  97 ILALMGITFFAQ-LLVGTFGSASLQRSLFVLT 127
                    344444555555.5577777788888888765 PP

  == domain 2  score: 25.6 bits;  conditional E-value: 7.9e-10
        DUF1751   6 pypwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvlltl 67 
                     y+wt +t+ f    +++++++++ ++++g ++Er+ gs+ +l+ +lv + i++l  v++++
  VIMSS10322802 132 EYVWTWVTSIFAHGGIVHIAFNAIVIFFFGPLVERYIGSRNFLILFLVSGAIAGLSQVAIQI 193
                    49****************************************************99888765 PP

  == domain 3  score: -2.5 bits;  conditional E-value: 0.43
        DUF1751  57 itnllvvlltll 68 
                     +nl v+l++++
  VIMSS10322802 223 NPNLTVYLYMIV 234
                    445555554443 PP



Or compare VIMSS10322802 to CDD or PaperBLAST