PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2018737 to PF08551 (DUF1751)

VIMSS2018737 has 225 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.8e-11   28.8   0.6    7.8e-11   28.8   0.6    2.1  3  VIMSS2018737  


Domain annotation for each sequence (and alignments):
>> VIMSS2018737  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.4   0.3      0.42      0.42      50      64 ..      14      28 ..      11      33 .. 0.52
   2 !   28.8   0.6   7.8e-11   7.8e-11       7      66 ..      57     116 ..      49     143 .. 0.88
   3 ?   -3.3   0.0      0.77      0.77      54      57 ..     160     163 ..     149     182 .. 0.55

  Alignments for each domain:
  == domain 1  score: -2.4 bits;  conditional E-value: 0.42
       DUF1751 50 Filvvnvitnllvvl 64
                  F+l+v+ ++ ll+++
  VIMSS2018737 14 FFLLVTALVFLLMLV 28
                  445544444444443 PP

  == domain 2  score: 28.8 bits;  conditional E-value: 7.8e-11
       DUF1751   7 ypwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvllt 66 
                    +w ll a fv + + +++v++l+l+++g+ +E++ gsk ++   l+ +++ nl v+++ 
  VIMSS2018737  57 QVWRLLSAIFVHIGWEHFIVNMLSLYYLGRQVEEIFGSKQFFFLYLLSGMMGNLFVFVFS 116
                   68*****************************************************99875 PP

  == domain 3  score: -3.3 bits;  conditional E-value: 0.77
       DUF1751  54 vnvi 57 
                   vn+i
  VIMSS2018737 160 VNII 163
                   2222 PP



Or compare VIMSS2018737 to CDD or PaperBLAST