PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001583752.1 to PF08551 (DUF1751)

XP_001583752.1 has 289 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.4e-12   32.5   2.4    5.4e-12   32.5   2.4    2.0  2  XP_001583752.1  


Domain annotation for each sequence (and alignments):
>> XP_001583752.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.5   2.4   5.4e-12   5.4e-12       8      96 ..      51     138 ..      42     140 .. 0.92
   2 ?   -1.5   0.1      0.22      0.22       7      16 ..     161     170 ..     155     192 .. 0.66

  Alignments for each domain:
  == domain 1  score: 32.5 bits;  conditional E-value: 5.4e-12
         DUF1751   8 pwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvlltlllylvtkseelllvpisGlagilagflva 96 
                      w ++t+++v + +++++++++t + +g++ Er+ g   ++ +i++ +v++nll +l+++++++  + e+++     G+ g+l+++ v+
  XP_001583752.1  51 YWRIFTSQYVHADIIHLAMNMMTFYQLGNFFERSVGTIAFFYYIFIFGVLSNLLDCLIAWFMAWGGRPEHFI-GSAVGFSGVLFSLTVI 138
                     59************************************************************9999998844.7788999999988885 PP

  == domain 2  score: -1.5 bits;  conditional E-value: 0.22
         DUF1751   7 ypwtlltasf 16 
                     ypw+ll+ + 
  XP_001583752.1 161 YPWALLLFMS 170
                     7777776544 PP



Or compare XP_001583752.1 to CDD or PaperBLAST