PaperBLAST – Find papers about a protein or its homologs

 

Align XP_956050.1 to PF08551 (DUF1751)

XP_956050.1 has 275 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.10
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-10   27.7   0.2    2.9e-10   26.9   0.2    1.4  1  XP_956050.1  


Domain annotation for each sequence (and alignments):
>> XP_956050.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.9   0.2   2.9e-10   2.9e-10       8      69 ..      46     106 ..      38     133 .. 0.86

  Alignments for each domain:
  == domain 1  score: 26.9 bits;  conditional E-value: 2.9e-10
      DUF1751   8 pwtlltasfveqnvwkvlvslltlllggkylErlWgskEllkFilvvnvitnllvvlltlll 69 
                   w +lt++++ +n  +vl+ +++l+++ +++Er+Wgs+ ++ Fil+ +++t+++  ++ +++
  XP_956050.1  46 LWRMLTYQLCYTNSSEVLFGAMSLYHM-RMVERFWGSRKYASFILLAALFTAIIPPIFLTVV 106
                  69**********************987.9***********************9976655544 PP



Or compare XP_956050.1 to CDD or PaperBLAST