NP_060647.2 has 1770 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-21 63.1 6.0 2.5e-21 62.1 6.0 1.6 1 NP_060647.2
Domain annotation for each sequence (and alignments):
>> NP_060647.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.1 6.0 2.5e-21 2.5e-21 1 64 [] 1619 1682 .. 1619 1682 .. 0.99
Alignments for each domain:
== domain 1 score: 62.1 bits; conditional E-value: 2.5e-21
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y+++RaeA h++kr e+++kA+eAy+ G++ A ++++G h +k++ean+ Aa +Ife+ N
NP_060647.2 1619 YDDYRAEAFLHQQKRMECYSKAKEAYRIGKKNVATFYAQQGTLHEQKMKEANHLAAIEIFEKVN 1682
9************************************************************987 PP
Or compare NP_060647.2 to CDD or PaperBLAST