PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060647.2 to PF08590 (DUF1771)

NP_060647.2 has 1770 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.3e-23   68.7   6.2    4.8e-23   67.7   6.2    1.6  1  NP_060647.2  


Domain annotation for each sequence (and alignments):
>> NP_060647.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.7   6.2   4.8e-23   4.8e-23       1      64 []    1619    1682 ..    1619    1682 .. 0.99

  Alignments for each domain:
  == domain 1  score: 67.7 bits;  conditional E-value: 4.8e-23
      DUF1771    1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64  
                   Y+++RaeA +h++kr e+++kA+eAyr G++  A ++++qG  h +km+ean+ Aa +Ife+ N
  NP_060647.2 1619 YDDYRAEAFLHQQKRMECYSKAKEAYRIGKKNVATFYAQQGTLHEQKMKEANHLAAIEIFEKVN 1682
                   9************************************************************987 PP



Or compare NP_060647.2 to CDD or PaperBLAST