PaperBLAST – Find papers about a protein or its homologs

 

Align NP_649378.1 to PF08590 (DUF1771)

NP_649378.1 has 969 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-16   47.0   2.7    1.4e-16   47.0   2.7    2.2  2  NP_649378.1  


Domain annotation for each sequence (and alignments):
>> NP_649378.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.3   0.0      0.71      0.71      29      45 ..     115     131 ..     114     133 .. 0.82
   2 !   47.0   2.7   1.4e-16   1.4e-16       2      62 ..     809     869 ..     808     871 .. 0.96

  Alignments for each domain:
  == domain 1  score: -3.3 bits;  conditional E-value: 0.71
      DUF1771  29 GdgaaAkelseqGkehg 45 
                  G+   A  l +q++ ++
  NP_649378.1 115 GKSTLAESLLRQAHLLD 131
                  88899999999999765 PP

  == domain 2  score: 47.0 bits;  conditional E-value: 1.4e-16
      DUF1771   2 erlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfee 62 
                  e+ R+ A +h ++++e++ kA++A +rG+   A ++se +k h++k++  n++Aa+ I+e 
  NP_649378.1 809 EETRNMAAHHSQLKAECYLKAKQAVQRGNSSVALYYSEIAKLHKQKIDVFNQRAANCIMEV 869
                  678*******************************************************985 PP



Or compare NP_649378.1 to CDD or PaperBLAST