Q08954 has 240 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-24 72.0 8.2 3.9e-24 71.1 8.2 1.5 1 Q08954
Domain annotation for each sequence (and alignments):
>> Q08954
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.1 8.2 3.9e-24 3.9e-24 1 64 [] 26 89 .. 26 89 .. 1.00
Alignments for each domain:
== domain 1 score: 71.1 bits; conditional E-value: 3.9e-24
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y+rlR++A+++++kr +l+++++ Ay++Gd+++A+else++k++ + ae++n qAae++f e+N
Q08954 26 YQRLRRLADEAYKKRDQLSHESQTAYQQGDKKLAHELSEKSKAQLKTAEDFNMQAAEYVFVENN 89
9**************************************************************9 PP
Or compare Q08954 to CDD or PaperBLAST