PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O64843 to PF08590 (DUF1771)

SwissProt::O64843 has 567 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.7e-22   65.9   9.3    3.6e-22   64.9   9.3    1.6  1  SwissProt::O64843  


Domain annotation for each sequence (and alignments):
>> SwissProt::O64843  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.9   9.3   3.6e-22   3.6e-22       1      64 []     408     471 ..     408     471 .. 0.99

  Alignments for each domain:
  == domain 1  score: 64.9 bits;  conditional E-value: 3.6e-22
            DUF1771   1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64 
                        Y +lR+eA+++ar+rn +fe+A++Ay  G++a Akels +G+ h+ +m++a+ +A eaI+++rN
  SwissProt::O64843 408 YSELREEARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRN 471
                        99*************************************************************9 PP



Or compare SwissProt::O64843 to CDD or PaperBLAST