SwissProt::O65573 has 519 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-19 57.0 9.2 3e-19 55.5 9.2 1.9 1 SwissProt::O65573
Domain annotation for each sequence (and alignments):
>> SwissProt::O65573
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.5 9.2 3e-19 3e-19 1 64 [] 356 419 .. 356 419 .. 0.99
Alignments for each domain:
== domain 1 score: 55.5 bits; conditional E-value: 3e-19
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y++lR+ A+++++ ++++qkAaeAy++G +a+A++ls++G+ ++a++a+++A++ If +rN
SwissProt::O65573 356 YHELRKGANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVARN 419
99************************************************************99 PP
Or compare SwissProt::O65573 to CDD or PaperBLAST