PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O65573 to PF08590 (DUF1771)

SwissProt::O65573 has 519 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.7e-19   55.7   9.0    8.4e-19   54.1   9.0    1.9  1  SwissProt::O65573  


Domain annotation for each sequence (and alignments):
>> SwissProt::O65573  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.1   9.0   8.4e-19   8.4e-19       1      64 []     356     419 ..     356     419 .. 0.99

  Alignments for each domain:
  == domain 1  score: 54.1 bits;  conditional E-value: 8.4e-19
            DUF1771   1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64 
                        Y++lR+ A+++++  +++++kAaeAy++G +a+A++ls++G+ + +++++a+++A++ If +rN
  SwissProt::O65573 356 YHELRKGANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVARN 419
                        99************************************************************99 PP



Or compare SwissProt::O65573 to CDD or PaperBLAST