PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6577074 to PF08590 (DUF1771)

VIMSS6577074 has 206 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.9e-24   72.2  12.0    8.2e-24   70.1  11.7    2.1  2  VIMSS6577074  


Domain annotation for each sequence (and alignments):
>> VIMSS6577074  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.1  11.7   8.2e-24   8.2e-24       1      64 []       4      67 ..       4      67 .. 0.99
   2 ?   -0.7   0.0       0.1       0.1      18      31 ..     162     175 ..     160     177 .. 0.83

  Alignments for each domain:
  == domain 1  score: 70.1 bits;  conditional E-value: 8.2e-24
       DUF1771  1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64
                  Ye++Ra A ++a+kr  lf++A+ Ay++G++a+A+els++Gk +ge+me++nr+Aa aI+ ++N
  VIMSS6577074  4 YEKFRALASKEAEKRGYLFQEAQHAYSAGNKAKAHELSQEGKLCGERMENYNRQAASAIYLYKN 67
                  9************************************************************998 PP

  == domain 2  score: -0.7 bits;  conditional E-value: 0.1
       DUF1771  18 lfekAaeAyrrGdg 31 
                   + ++ +eAy+r ++
  VIMSS6577074 162 CIQEPQEAYSRPQH 175
                   89999****99766 PP



Or compare VIMSS6577074 to CDD or PaperBLAST