PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6586494 to PF08590 (DUF1771)

VIMSS6586494 has 240 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.8e-22   65.2   7.7      5e-22   64.4   7.7    1.4  1  VIMSS6586494  


Domain annotation for each sequence (and alignments):
>> VIMSS6586494  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.4   7.7     5e-22     5e-22       1      64 []      26      89 ..      26      89 .. 1.00

  Alignments for each domain:
  == domain 1  score: 64.4 bits;  conditional E-value: 5e-22
       DUF1771  1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64
                  Y+rlR+ Ade ++kr++l+++++ Ay++Gd++ A+else+ k + + +e  n +Aae++f e+N
  VIMSS6586494 26 YQRLRRLADEAYKKRDQLSHESQTAYQQGDKKLAHELSEKSKAQLKTAEDFNMQAAEYVFVENN 89
                  9**************************************************************9 PP



Or compare VIMSS6586494 to CDD or PaperBLAST