PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016863886.1 to PF08590 (DUF1771)

XP_016863886.1 has 1885 amino acids

Query:       DUF1771  [M=64]
Accession:   PF08590.10
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.1e-23   68.8   6.2    5.2e-23   67.6   6.2    1.7  1  XP_016863886.1  


Domain annotation for each sequence (and alignments):
>> XP_016863886.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.6   6.2   5.2e-23   5.2e-23       1      64 []    1734    1797 ..    1734    1797 .. 0.99

  Alignments for each domain:
  == domain 1  score: 67.6 bits;  conditional E-value: 5.2e-23
         DUF1771    1 YerlRaeAdeharkrnelfekAaeAyrrGdgaaAkelseqGkehgekmeeanreAaeaIfeerN 64  
                      Y+++RaeA +h++kr e+++kA+eAyr G++  A ++++qG  h +km+ean+ Aa +Ife+ N
  XP_016863886.1 1734 YDDYRAEAFLHQQKRMECYSKAKEAYRIGKKNVATFYAQQGTLHEQKMKEANHLAAIEIFEKVN 1797
                      9************************************************************987 PP



Or compare XP_016863886.1 to CDD or PaperBLAST