PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A0A067XMT5 to PF08592 (DUF1772)

SwissProt::A0A067XMT5 has 141 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.5e-33  102.2   6.7    1.8e-33  102.0   6.7    1.0  1  SwissProt::A0A067XMT5  


Domain annotation for each sequence (and alignments):
>> SwissProt::A0A067XMT5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.0   6.7   1.8e-33   1.8e-33       4     135 ..       2     137 ..       1     138 [. 0.91

  Alignments for each domain:
  == domain 1  score: 102.0 bits;  conditional E-value: 1.8e-33
                DUF1772   4 lafslfvvPallslpassslllkqwrrlfkrgkavfpplallsalafaylaaraasrgarllylaaaallllsivpyTllvmvPtNnk 91 
                            + + l+ vP+ll++ a++  l++qw+r++ +g +++ppla+++ ++++++  r++s+++++++la+aa+++++++p+T++v  PtNn+
  SwissProt::A0A067XMT5   2 MGLPLMAVPMLLDTGADPVYLARQWARMYYYGVRTMPPLAITTFILYVWTIIRRRSQHQAWYILAVAAVVTMGMIPFTWYVLAPTNNA 89 
                            678899*********88877****************************999888888888888899********************** PP

                DUF1772  92 Laal....keedakekedeaevrellerWgrlnlvRavlalaaavlgl 135
                            L++l    ++++++++ + +ev ell rW++l+ +R++++l+++v++l
  SwissProt::A0A067XMT5  90 LFRLaegpEAASGTTAGSLEEVTELLVRWNKLHIARSLFPLTGVVIAL 137
                            99998775467777777889*************************987 PP



Or compare SwissProt::A0A067XMT5 to CDD or PaperBLAST