PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::M1VWN5 to PF08592 (DUF1772)

SwissProt::M1VWN5 has 174 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.7e-35  107.9   6.4    3.5e-35  107.5   6.4    1.1  1  SwissProt::M1VWN5  


Domain annotation for each sequence (and alignments):
>> SwissProt::M1VWN5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.5   6.4   3.5e-35   3.5e-35       1     135 [.      23     159 ..      23     161 .. 0.87

  Alignments for each domain:
  == domain 1  score: 107.5 bits;  conditional E-value: 3.5e-35
            DUF1772   1 GlilafslfvvPallslpassslllkqwrrlfkrgkavfpplallsalafaylaaraasrgarllylaaaallllsivpyTllvmvPtNnkL 92 
                        G+++++s++++P+ll+++++++ l +qw+rl+++g++++p++++++a+++++++ + +++ +     +aa++l+l+i+pyT+l+m+PtNn+L
  SwissProt::M1VWN5  23 GAMFSVSAIMIPTLLDTNKEPAGLTTQWARLYHYGSVLMPSMSVAIAAVYGFASTQYRQSPQGMRC-LAAGALTLAIAPYTWLAMIPTNNAL 113
                        99******************999***************************9555444444444444.678899999**************** PP

            DUF1772  93 aal..k.eedakekedeaevrellerWgrlnlvRavlalaaavlgl 135
                        +a+  + +  a +++  +++r+l+++W  l+ +R++l+la+a++g+
  SwissProt::M1VWN5 114 FAMaaSaPGFAGMQDANEKARDLVMKWVVLHSIRSILPLAGAIMGF 159
                        ***88446666677778999***********************997 PP



Or compare SwissProt::M1VWN5 to CDD or PaperBLAST