PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::M2WJF5 to PF08592 (DUF1772)

SwissProt::M2WJF5 has 185 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    8.7e-35  106.2   7.6      1e-34  106.0   7.6    1.1  1  SwissProt::M2WJF5  


Domain annotation for each sequence (and alignments):
>> SwissProt::M2WJF5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.0   7.6     1e-34     1e-34       1     136 [.      41     177 ..      41     178 .. 0.95

  Alignments for each domain:
  == domain 1  score: 106.0 bits;  conditional E-value: 1e-34
            DUF1772   1 GlilafslfvvPallslpassslllkqwrrlfkrgkavfpplallsalafaylaaraasrgarllylaaaallllsivpyTllvmvPtNnkL 92 
                        G+++++ l+++P +l++++ +s+ll+qw+r+f rg+ + p++++++ l++ y+a ++++rga++  +a++a+++++++p+T+++m  +Nn+L
  SwissProt::M2WJF5  41 GAMMSLFLLTIPVILETTTVPSQLLNQWHRIFYRGHIQGPLISIATGLLYSYAAYQRSQRGAAWKPFAVSAAVTVAMIPFTWVFMANVNNSL 132
                        899************************************************9997777777777777999999******************* PP

            DUF1772  93 aalk.eedakekedeaevrellerWgrlnlvRavlalaaavlgll 136
                        +++   +++  + + +e++ l++ Wg +n+vRa+++l++avlgll
  SwissProt::M2WJF5 133 FRAVaVTEKGGEGNWNEAQGLVRSWGAWNAVRALFPLSGAVLGLL 177
                        ***9899999999******************************97 PP



Or compare SwissProt::M2WJF5 to CDD or PaperBLAST