PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6631721 to PF08592 (DUF1772)

VIMSS6631721 has 172 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.9e-18   52.3   0.4    5.5e-18   51.8   0.3    1.3  1  VIMSS6631721  


Domain annotation for each sequence (and alignments):
>> VIMSS6631721  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.8   0.3   5.5e-18   5.5e-18      10     137 .]      36     165 ..      18     165 .. 0.79

  Alignments for each domain:
  == domain 1  score: 51.8 bits;  conditional E-value: 5.5e-18
       DUF1772  10 vvPallslpasssl....llkqwrrlfkrg.kavfpplallsalafaylaaraasrgarllylaaaallllsivpyTll.vmvPtNnkLaalkeeda 100
                   +vP l       +     + k+w+  fkr+ + +++  +l ++l f+ +a  + s+ +r+++++ +a+ +l i+p+T++  + P+N++L++   +++
  VIMSS6631721  36 IVPLLNGRFGAVDIdekkRIKMWSIYFKRAaTGLVGGSVLSALLNFT-TAYIHPSPLTRRITFI-SAVTSLLILPITFAsGILPINSRLFEI--AKG 128
                   66666666644444667789**********77777777777777776.5556888888999956.7777777****9984689*******99..577 PP

       DUF1772 101 kekedeaevrellerWgrlnlvRavlalaaavlglla 137
                   +e+++++ev++l+e Wg+ +l+R+ + + a vl ++a
  VIMSS6631721 129 AETTKDDEVKSLVEAWGKKHLLRMPAYTGAWVLSFFA 165
                   88999***************************99876 PP



Or compare VIMSS6631721 to CDD or PaperBLAST