PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001481565.1 to PF08592 (DUF1772)

XP_001481565.1 has 175 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-34  105.1   4.8    2.6e-34  104.7   4.8    1.2  1  XP_001481565.1  


Domain annotation for each sequence (and alignments):
>> XP_001481565.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.7   4.8   2.6e-34   2.6e-34       1     137 []      24     172 ..      24     172 .. 0.93

  Alignments for each domain:
  == domain 1  score: 104.7 bits;  conditional E-value: 2.6e-34
         DUF1772   1 GlilafslfvvPallslpasssl....llkqwrrlfkrgkavfpplallsalafayla.........araasrgarllylaaaallllsivpyTl 82 
                     G i+++s++  Pal ++ ++++     ++++w+ ++++gk + pp+a+++a++f+yl+         +  a++ ++ ly a+++ll+++ivpyT+
  XP_001481565.1  24 GNIFSLSFIPNPALIQTLHEKQVtpsaAARLWAGIYSAGKTQNPPIAAATAAVFFYLSwsvrdgtalSLVAAPNSSFLY-AVSGLLTVGIVPYTF 117
                     889******999999888776559999****************************9999*******8777788888888.99************* PP

         DUF1772  83 lvmvPtNnkLaalkeedakekedeaevrellerWgrlnlvRavlalaaavlglla 137
                     ++m+ tN++L+a+  ++ +++++ +ev++l+erWg ln+vR +++l++av++++a
  XP_001481565.1 118 AFMMGTNRSLEAKVGSKDDSEATRTEVESLMERWGVLNAVRGAFPLVGAVVAAVA 172
                     *************9888889999****************************9986 PP



Or compare XP_001481565.1 to CDD or PaperBLAST