PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002379935.1 to PF08592 (DUF1772)

XP_002379935.1 has 163 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.2e-27   82.3   2.8    3.3e-27   81.7   2.8    1.1  1  XP_002379935.1  


Domain annotation for each sequence (and alignments):
>> XP_002379935.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.7   2.8   3.3e-27   3.3e-27       1     134 [.      19     153 ..      19     155 .. 0.94

  Alignments for each domain:
  == domain 1  score: 81.7 bits;  conditional E-value: 3.3e-27
         DUF1772   1 GlilafslfvvPallslpassslllkqwrrlfkrgkavfpplallsalafaylaaraasrgarllylaaaallllsivpyTllvmvPtNnkLaal 95 
                     G+++++  + +Pa+l++ ++s +l+   rrl+ +g+    +l+l+++l++a +++++  +++++l+ aaa+l ++s+vp+T +vm  +Nn+La l
  XP_002379935.1  19 GAMMSVYGLAMPAFLQTVTQSGQLVGYQRRLYLIGTTKGRVLGLTTTLLYASVSVHQYLARKPWLVSAAAGLTTISLVPFTEIVMASINNALACL 113
                     7888888899*************************999999**********777788888899999899999*********************** PP

         DUF1772  96 k.eedakekedeaevrellerWgrlnlvRavlalaaavlg 134
                     + e+++    + +e+++l+++W r+n+vRa+++la+a lg
  XP_002379935.1 114 EtETNKGVVISREETEQLVRKWDRFNAVRALFPLAGAFLG 153
                     99***********************************998 PP



Or compare XP_002379935.1 to CDD or PaperBLAST