PaperBLAST – Find papers about a protein or its homologs

 

Align XP_012053839.1 to PF08592 (DUF1772)

XP_012053839.1 has 172 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-18   54.0   0.3    1.6e-18   53.6   0.2    1.3  1  XP_012053839.1  


Domain annotation for each sequence (and alignments):
>> XP_012053839.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   53.6   0.2   1.6e-18   1.6e-18      10     137 .]      36     165 ..      18     165 .. 0.77

  Alignments for each domain:
  == domain 1  score: 53.6 bits;  conditional E-value: 1.6e-18
         DUF1772  10 vvPallslpasssl....llkqwrrlfkrg.kavfpplallsalafaylaaraasrgarllylaaaallllsivpyTll.vmvPtNnkLaalkee 98 
                     ++P l +     +       ++w+  fkr+ + +++  +l ++l f+ +a  + s+ +r+++++ +a+ +l ivp+T++  + P+Nn+L++   +
  XP_012053839.1  36 IIPLLNDRFGAVDIdekkKIEMWSIYFKRAsTGLVGGSVLSALLNFT-TAYIHPSPLTRRITFI-SAVTSLLIVPITFAsGILPINNRLFEI--A 126
                     5566665554444466666789********77777777777777776.5556888888999956.7777777*****984689*******99..5 PP

         DUF1772  99 dakekedeaevrellerWgrlnlvRavlalaaavlglla 137
                     +++e++ ++ev++l+++Wg  +l+R+ + +aa vl ++a
  XP_012053839.1 127 KGAETTRDDEVKSLVKTWGEKHLLRMPAYTAAWVLSFFA 165
                     77789999***************************9876 PP



Or compare XP_012053839.1 to CDD or PaperBLAST