PaperBLAST – Find papers about a protein or its homologs

 

Align XP_751386.2 to PF08592 (DUF1772)

XP_751386.2 has 161 amino acids

Query:       DUF1772  [M=137]
Accession:   PF08592.11
Description: Domain of unknown function (DUF1772)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-37  114.9   4.7    2.3e-37  114.6   4.7    1.1  1  XP_751386.2  


Domain annotation for each sequence (and alignments):
>> XP_751386.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  114.6   4.7   2.3e-37   2.3e-37       1     135 [.      23     155 ..      23     157 .. 0.96

  Alignments for each domain:
  == domain 1  score: 114.6 bits;  conditional E-value: 2.3e-37
      DUF1772   1 GlilafslfvvPallslpassslllkqwrrlfkrgkavfpplallsalafaylaaraasrgarllylaaaallllsivpyTllvmvPtNnkLaalkee 98 
                  Gl++ +s++ +P +l++ +++s+ll+++ rl+++g++++p+la++++l+++y+a++ + +g ++l  ++aa+ ++s+vp+T+lvm PtNn+L+++   
  XP_751386.2  23 GLMMGLSVVDIPVVLDTATQASQLLQHFTRLYDIGHKMMPSLAVTTCLLYGYTASSTRTTGGSGLPHIIAAVTTISMVPFTWLVMAPTNNALFRMH-- 118
                  89****************************************************9999999999999****************************5.. PP

      DUF1772  99 dakekedeaevrellerWgrlnlvRavlalaaavlgl 135
                  ++ ++++  evr+ll rW++l++vR++++l+++vlgl
  XP_751386.2 119 ANPAAANLGEVRRLLVRWAQLHAVRSLFPLMGSVLGL 155
                  56677899***************************98 PP



Or compare XP_751386.2 to CDD or PaperBLAST