biolip::7bbmA has 153 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-52 162.3 0.0 5e-52 162.2 0.0 1.0 1 biolip::7bbmA Domain annotation for each sequence (and alignments): >> biolip::7bbmA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.2 0.0 5e-52 5e-52 2 151 .] 7 152 .. 6 152 .. 0.97 Alignments for each domain: == domain 1 score: 162.2 bits; conditional E-value: 5e-52 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekkt 97 ++pl+ LlGtW+G+Gegeypti +f+ygeei+fsh gkp+++Y+++tw+l++g+pl +E+Gy+r ++g++e+++a +tG+ve+++G+++ +++ biolip::7bbmA 7 VAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPLLAESGYFR-PRPDGSIEVVIACSTGLVEVQKGTYNVDEQS 101 589*************************************************************.68899*********************9999* PP THAP4_heme-bd 98 lelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++l+sd + +a++v++++r+++lvdg+L+y+v+++++++plq+hl+a L++ biolip::7bbmA 102 IKLKSDLV---GNASKVKEISREFELVDGKLSYVVRLSTTTNPLQPHLKAILDK 152 ******88...68999**********************************9987 PP
Or compare biolip::7bbmA to CDD or PaperBLAST