VIMSS148619 has 60 amino acids
Query: DUF1869 [M=59]
Accession: PF08956.14
Description: Domain of unknown function (DUF1869)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-37 111.0 2.0 1e-36 110.9 2.0 1.0 1 VIMSS148619
Domain annotation for each sequence (and alignments):
>> VIMSS148619
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.9 2.0 1e-36 1e-36 2 59 .] 3 60 .] 2 60 .] 0.98
Alignments for each domain:
== domain 1 score: 110.9 bits; conditional E-value: 1e-36
DUF1869 2 eaefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnvCGW 59
+a++++TvTN++NGVSVD++++++++L +pevaA+vvKdL+N+vR+Yd+++e++vCGW
VIMSS148619 3 KATYTVTVTNNSNGVSVDYETEAPMTLLVPEVAAEVVKDLVNTVRSYDTENEHDVCGW 60
799******************************************************* PP
Or compare VIMSS148619 to CDD or PaperBLAST