PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10426734 to PF09430 (EMC7_beta-sandw)

VIMSS10426734 has 773 amino acids

Query:       EMC7_beta-sandw  [M=122]
Accession:   PF09430.14
Description: ER membrane protein complex subunit 7, beta-sandwich domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.4e-12   33.3   0.1    6.5e-12   32.0   0.1    1.7  1  VIMSS10426734  


Domain annotation for each sequence (and alignments):
>> VIMSS10426734  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.0   0.1   6.5e-12   6.5e-12       2      65 ..      34      95 ..      33     119 .. 0.87

  Alignments for each domain:
  == domain 1  score: 32.0 bits;  conditional E-value: 6.5e-12
  EMC7_beta-sandw  2 kpnnllantrvlldsgshkfkvpvrkDGsFvfrdvpegsYvLevespdleFepvrVdvkkkgka 65
                     +++nl++n++++l+++ +   ++++++G F++ ++p+g+Y+L +  ++++ +++ V+++++ + 
    VIMSS10426734 34 EQQNLVSNAHIYLKDSNY--GAYTNQNGFFSIANIPKGEYTLVISEIGFIRKELTVNIQSNKTI 95
                     5799*********88888..***************************************55444 PP



Or compare VIMSS10426734 to CDD or PaperBLAST