VIMSS659646 has 777 amino acids
Query: EMC7_beta-sandw [M=122]
Accession: PF09430.14
Description: ER membrane protein complex subunit 7, beta-sandwich domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-11 30.6 0.0 3.8e-11 29.5 0.0 1.6 1 VIMSS659646
Domain annotation for each sequence (and alignments):
>> VIMSS659646
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.5 0.0 3.8e-11 3.8e-11 2 68 .. 37 101 .. 36 138 .. 0.79
Alignments for each domain:
== domain 1 score: 29.5 bits; conditional E-value: 3.8e-11
EMC7_beta-sandw 2 kpnnllantrvlldsgshkfkvpvrkDGsFvfrdvpegsYvLevespdleFepvrVdvkkkgkarar 68
k+ n ++n++++l+++ + ++ +++ G+Fv+++vp g+Y+L + s+++ e++ +++ +k+++ +
VIMSS659646 37 KNGNSISNVKIILQESRK--TTITNEKGEFVLNHVPPGKYTLVAISRGYQSETISITIGEKDEKTQF 101
567899*******99999..9*************************************955544433 PP
Or compare VIMSS659646 to CDD or PaperBLAST