PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9NZQ3 to PF09431 (DUF2013)

SwissProt::Q9NZQ3 has 722 amino acids

Query:       DUF2013  [M=138]
Accession:   PF09431.10
Description: Protein of unknown function (DUF2013)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.4e-35  107.1   0.0      9e-35  106.1   0.0    1.5  1  SwissProt::Q9NZQ3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9NZQ3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.1   0.0     9e-35     9e-35       2     137 ..     548     682 ..     547     683 .. 0.96

  Alignments for each domain:
  == domain 1  score: 106.1 bits;  conditional E-value: 9e-35
            DUF2013   2 delnysviklllalneqfmvasleskelenkvlkvlsekksssktfgenlilllNReedlvlql........lilklLyllfttsetaelfY 85 
                        ++l + +++lllaln ++  a+      +n ++ +ls k+ ++k f+e+l+lllNR +d+v  +        ++lk+L+++f +++ta +fY
  SwissProt::Q9NZQ3 548 EQLPDLCVNLLLALNLHLPAAD------QNVIMAALS-KHANVKIFSEKLLLLLNRGDDPVRIFkhepqpphSVLKFLQDVFGSPATAAIFY 632
                        688999************9999......9********.999********************99999999999******************** PP

            DUF2013  86 tnDlkVLvDviiRelsdlsdeeeeklrhtyLrvlhpllkntqlseekykree 137
                        + D++ L+D+++R ++dls  +++klr++yL+++h ++++t + +++++  +
  SwissProt::Q9NZQ3 633 HTDMMALIDITVRHIADLS--PGDKLRMEYLSLMHAIVRTTPYLQHRHRLPD 682
                        ******************8..***************************9876 PP



Or compare SwissProt::Q9NZQ3 to CDD or PaperBLAST