PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581428 to PF09431 (DUF2013)

VIMSS6581428 has 491 amino acids

Query:       DUF2013  [M=138]
Accession:   PF09431.10
Description: Protein of unknown function (DUF2013)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.2e-49  151.4   6.4    2.4e-48  150.0   6.4    1.7  1  VIMSS6581428  


Domain annotation for each sequence (and alignments):
>> VIMSS6581428  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.0   6.4   2.4e-48   2.4e-48       1     138 []     235     372 ..     235     372 .. 0.95

  Alignments for each domain:
  == domain 1  score: 150.0 bits;  conditional E-value: 2.4e-48
       DUF2013   1 ddelnysviklllalneqfmvasleskelenkvlkvlsekksssktfgenlilllNReedlvlqllilklLyllft...tsetaelfYtnDlkVLvD 94 
                   dd++n++ +klllalneq+m+ ++e  ++enkv+k+l+ + s s+ f+e l+l++NR++d+ lq++++k++yl++t   + + +++fYtnDl+VL+D
  VIMSS6581428 235 DDMFNNAEFKLLLALNEQYMMFAKE-YDIENKVYKYLI-NGSVSRCFTELLLLKFNRASDPPLQIMMCKIIYLILTprgDYSPMNFFYTNDLRVLID 329
                   799*******************965.8***********.*************************************766667789************ PP

       DUF2013  95 viiRelsdlsdeeeeklrhtyLrvlhpllkntqlseekykreel 138
                   v+iRel+++s e+ee lr+t Lrvl pllkntqls+++y++++l
  VIMSS6581428 330 VLIRELQNIS-EDEEVLRNTLLRVLIPLLKNTQLSKTHYRKDDL 372
                   *********5.******************************986 PP



Or compare VIMSS6581428 to CDD or PaperBLAST