PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006243816.1 to PF09431 (DUF2013)

XP_006243816.1 has 656 amino acids

Query:       DUF2013  [M=138]
Accession:   PF09431.10
Description: Protein of unknown function (DUF2013)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-36  111.4   0.2    3.9e-36  110.5   0.2    1.5  1  XP_006243816.1  


Domain annotation for each sequence (and alignments):
>> XP_006243816.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.5   0.2   3.9e-36   3.9e-36       2     138 .]     482     617 ..     481     617 .. 0.97

  Alignments for each domain:
  == domain 1  score: 110.5 bits;  conditional E-value: 3.9e-36
         DUF2013   2 delnysviklllalneqfmvasleskelenkvlkvlsekksssktfgenlilllNReedlvlql........lilklLyllfttsetaelfYtnD 88 
                     ++l + +++lllaln +++  +      +n ++ +ls k++++k f+e+l+lllNR +d+v  +        ++lk+L+++f++ +ta++fY+ D
  XP_006243816.1 482 EQLPDLCMNLLLALNLHLTAPD------QNVIMAALS-KHTNVKIFSEKLLLLLNRGDDPVRIFrhepqpphSVLKFLQDVFSSAATASIFYHTD 569
                     688999**************99......9********.99*********************99999999999*********************** PP

         DUF2013  89 lkVLvDviiRelsdlsdeeeeklrhtyLrvlhpllkntqlseekykreel 138
                     ++ L+D+++R+++dls  +++klr++yL+++h ++++t + +++++ ++l
  XP_006243816.1 570 MMALIDITVRQIADLS--PGDKLRMEYLSLMHAVVRSTPYLQHRHRLSDL 617
                     ***************8..****************************9875 PP



Or compare XP_006243816.1 to CDD or PaperBLAST