PaperBLAST – Find papers about a protein or its homologs

 

Align NP_005427.2 to PF09755 (DUF2046)

NP_005427.2 has 474 amino acids

Query:       DUF2046  [M=304]
Accession:   PF09755.9
Description: Uncharacterized conserved protein H4 (DUF2046)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.2e-151  490.2  50.3   1.5e-151  489.9  50.3    1.1  1  NP_005427.2  


Domain annotation for each sequence (and alignments):
>> NP_005427.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  489.9  50.3  1.5e-151  1.5e-151      18     304 .]      51     337 ..      42     337 .. 0.99

  Alignments for each domain:
  == domain 1  score: 489.9 bits;  conditional E-value: 1.5e-151
      DUF2046  18 pssvkreelqkrveslqqenrvlkieldtyklrvkalqeenrelrkasvniqakaeqeeefisntllkkiqalkkeketlalnyeqeeefltndlsrk 115
                   s+++ eel++r++slqqen+vlkiel+tykl++kalqeenr+lrkasv+iqa+aeqeeefisntl+kkiqal+keketla+nye+eeefltn+lsrk
  NP_005427.2  51 ISPFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRK 148
                  599*********************************************************************************************** PP

      DUF2046 116 lsqlrqekveleqtlekeqevqvnklmrkiekleaevlakqtkleqlrrekvelentleqeqealvnrlWkrldkleaekrllqekldqpvsappsPr 213
                  l+ql++ek+eleq+le+eqe+qvnklm+ki+kle+++ +kq +leqlrrek++lentleqeqealvnrlWkr+dkleaekr+lqekldqpvsappsPr
  NP_005427.2 149 LMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPR 246
                  ************************************************************************************************** PP

      DUF2046 214 dlvsegdtaeklsahikalrkeverlrkqlkksqkeheekmaqfakeerqireenvrlqrklqleverrealsrhlsesesslemdderyf 304
                  d+++e d++e++++hi+ l++everl+kql+++q +h+ekmaq+ +eer++reen+rlqrklq+e+erreal+r+lsesesslemdderyf
  NP_005427.2 247 DISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYF 337
                  ******************************************************************************************8 PP



Or compare NP_005427.2 to CDD or PaperBLAST