PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006514339.1 to PF09755 (DUF2046)

XP_006514339.1 has 412 amino acids

Query:       DUF2046  [M=304]
Accession:   PF09755.9
Description: Uncharacterized conserved protein H4 (DUF2046)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   6.1e-154  497.7  43.6   7.5e-154  497.4  43.6    1.0  1  XP_006514339.1  


Domain annotation for each sequence (and alignments):
>> XP_006514339.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  497.4  43.6  7.5e-154  7.5e-154      17     304 .]      43     330 ..      25     330 .. 0.98

  Alignments for each domain:
  == domain 1  score: 497.4 bits;  conditional E-value: 7.5e-154
         DUF2046  17 epssvkreelqkrveslqqenrvlkieldtyklrvkalqeenrelrkasvniqakaeqeeefisntllkkiqalkkeketlalnyeqeeefltnd 111
                       s+++ eel++r++slqqen+vlkiel+tykl++kalqeenr+lrkasv+iqa+aeqeeefisntl+kkiqal+keketla+nye+eeefltn+
  XP_006514339.1  43 VISPFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNE 137
                     3599******************************************************************************************* PP

         DUF2046 112 lsrklsqlrqekveleqtlekeqevqvnklmrkiekleaevlakqtkleqlrrekvelentleqeqealvnrlWkrldkleaekrllqekldqpv 206
                     lsrkl+ql++ek+eleq+le+eqe+qvnklm+ki+kle+++ +kq +leqlrrek++lentleqeqealvnrlWkr+dkleaekr+lqekldqpv
  XP_006514339.1 138 LSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPV 232
                     *********************************************************************************************** PP

         DUF2046 207 sappsPrdlvsegdtaeklsahikalrkeverlrkqlkksqkeheekmaqfakeerqireenvrlqrklqleverrealsrhlsesesslemdde 301
                     sappsPrd+++e d++e++++hi+ l++everl+kql+++q +h+ekmaq+ +eer++reen+rlqrklq+e+erreal+r+lsesesslemdde
  XP_006514339.1 233 SAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDE 327
                     *********************************************************************************************** PP

         DUF2046 302 ryf 304
                     ryf
  XP_006514339.1 328 RYF 330
                     **8 PP



Or compare XP_006514339.1 to CDD or PaperBLAST