PaperBLAST – Find papers about a protein or its homologs

 

Align NP_391190.1 to PF09922 (DUF2154)

NP_391190.1 has 241 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.4e-39  119.2   0.8    6.1e-39  118.7   0.8    1.2  1  NP_391190.1  


Domain annotation for each sequence (and alignments):
>> NP_391190.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  118.7   0.8   6.1e-39   6.1e-39       1     114 []     126     238 ..     126     238 .. 0.98

  Alignments for each domain:
  == domain 1  score: 118.7 bits;  conditional E-value: 6.1e-39
      DUF2154   1 liGdqklgkepyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllneslkleseeyeeae 98 
                  +iG+ +++k+p++l+d+n+s +iGd++iDL+ka++pege++ivi+++iG+v+i+VP+d+ev v+++v++Gd+++++ k++g l+ +++  s+++ e++
  NP_391190.1 126 FIGELQMMKQPFDLNDLNVSGFIGDIKIDLSKAMIPEGESTIVISGVIGNVDIYVPSDLEVAVSSAVFIGDINLIGSKKSG-LSTKVYAASTDFSESK 222
                  79*******************************************************************************.7888************ PP

      DUF2154  99 kkvkiivslliGdveV 114
                  ++vk++vsl+iGdv+V
  NP_391190.1 223 RRVKVSVSLFIGDVDV 238
                  **************98 PP



Or compare NP_391190.1 to CDD or PaperBLAST