PaperBLAST – Find papers about a protein or its homologs

 

Align NP_722171.1 to PF09922 (DUF2154)

NP_722171.1 has 228 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.9e-12   32.0   0.1    7.3e-12   31.5   0.1    1.3  1  NP_722171.1  


Domain annotation for each sequence (and alignments):
>> NP_722171.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.5   0.1   7.3e-12   7.3e-12       3      80 ..     129     206 ..     127     224 .. 0.87

  Alignments for each domain:
  == domain 1  score: 31.5 bits;  conditional E-value: 7.3e-12
      DUF2154   3 GdqklgkepyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekea 80 
                  ++ +   ++ el++i i++ +G+  +DL++a+   +   i i   +G++++ +P+++++  ++ + f ++++ +  ++
  NP_722171.1 129 SENTSYVTSQELNKIIIDTKFGEQSVDLSQAQFMTDSPEIHIDVSFGETNLRIPNNWKIINKTHSPFASISFSGFPST 206
                  56666778999**********************************************************999765544 PP



Or compare NP_722171.1 to CDD or PaperBLAST