PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS101818 to PF09922 (DUF2154)

VIMSS101818 has 228 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.7e-34  103.3   1.2    5.8e-34  102.7   1.2    1.3  1  VIMSS101818  


Domain annotation for each sequence (and alignments):
>> VIMSS101818  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.7   1.2   5.8e-34   5.8e-34       1      95 [.     132     226 ..     132     228 .] 0.98

  Alignments for each domain:
  == domain 1  score: 102.7 bits;  conditional E-value: 5.8e-34
      DUF2154   1 liGdqklgkepyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllneslkleseeye 95 
                  +iG+ ++++++y ++dini +i+G++t+DLt++++++ +++ivirk++G+++ilVP dv+v++++s+i+G+v++++ ++++l+nes+k+++++ +
  VIMSS101818 132 WIGTANYESDYYCFDDINIIRISGNDTVDLTNVIVTGMDNIIVIRKIFGNTTILVPIDVTVTLDVSSIYGSVDFFRCQQYDLRNESIKFKETDNQ 226
                  9*****************************************************************************************99865 PP



Or compare VIMSS101818 to CDD or PaperBLAST