PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS160087 to PF09922 (DUF2154)

VIMSS160087 has 237 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.4e-41  125.1   2.0    1.2e-40  124.3   2.0    1.4  1  VIMSS160087  


Domain annotation for each sequence (and alignments):
>> VIMSS160087  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  124.3   2.0   1.2e-40   1.2e-40       1     114 []     122     234 ..     122     234 .. 0.98

  Alignments for each domain:
  == domain 1  score: 124.3 bits;  conditional E-value: 1.2e-40
      DUF2154   1 liGdqklgkepyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllneslkleseeyeeae 98 
                  ++G+q++ + +ye++dini+++iGdt +DL ++vlp ge++i+ir++ G+++ilVP d+++ +e+s+ifG+++  d++++ + n+s+k++s++ye++ 
  VIMSS160087 122 WFGNQRILDVVYEWDDINIQTGIGDTILDLGNTVLPTGESIIMIRSVSGKIRILVPFDIGICIEHSAIFGNIQ-YDKESTSIQNNSIKVYSDNYESSA 218
                  9************************************************************************.58888899**************** PP

      DUF2154  99 kkvkiivslliGdveV 114
                  +kvki++s+++Gd+eV
  VIMSS160087 219 RKVKIMTSVIFGDLEV 234
                  **************98 PP



Or compare VIMSS160087 to CDD or PaperBLAST