PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2127098 to PF09922 (DUF2154)

VIMSS2127098 has 191 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-20   58.1   0.7    5.2e-20   57.7   0.7    1.2  1  VIMSS2127098  


Domain annotation for each sequence (and alignments):
>> VIMSS2127098  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.7   0.7   5.2e-20   5.2e-20      25     114 .]     100     188 ..      79     188 .. 0.93

  Alignments for each domain:
  == domain 1  score: 57.7 bits;  conditional E-value: 5.2e-20
       DUF2154  25 dttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllneslkleseeyeeaekkvkiivslliGdveV 114
                   ++ iDL  +  +   + + i+k+ G++ki+VP+dv+v ++ ++ +G vk+++e  +     ++++ s++ ++aek++ki +++  G++eV
  VIMSS2127098 100 NDIIDLDDVTFKPSGNSLSIKKMTGNTKIIVPDDVGVALDLTTNAGLVKIFNEAAQI-NAGNIHYFSDNLDQAEKRIKINIRVDSGNIEV 188
                   679************************************************998875.6778***************************9 PP



Or compare VIMSS2127098 to CDD or PaperBLAST