VIMSS865012 has 252 amino acids
Query: LiaF-like_C [M=114]
Accession: PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-13 35.2 0.4 1e-12 34.2 0.4 1.5 1 VIMSS865012
Domain annotation for each sequence (and alignments):
>> VIMSS865012
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 34.2 0.4 1e-12 1e-12 10 81 .. 159 230 .. 151 249 .. 0.91
Alignments for each domain:
== domain 1 score: 34.2 bits; conditional E-value: 1e-12
LiaF-like_C 10 epyelediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldekeag 81
++ +l+ ++i++ +Gd+ + L a +e ++ i+ + dv+i++P+d++v+ +++ f +v++ ek++g
VIMSS865012 159 HSQNLKTVTIDASMGDVSVYLDDAKAAGNEVIMNINTSMCDVNIYIPSDWQVENNMQNNFSDVDIDYEKSTG 230
56789999********************************************************99999988 PP
Or compare VIMSS865012 to CDD or PaperBLAST