PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS865012 to PF09922 (DUF2154)

VIMSS865012 has 252 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.8e-13   35.3   0.3    9.1e-13   34.4   0.3    1.4  1  VIMSS865012  


Domain annotation for each sequence (and alignments):
>> VIMSS865012  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.4   0.3   9.1e-13   9.1e-13      11      81 ..     160     230 ..     151     248 .. 0.92

  Alignments for each domain:
  == domain 1  score: 34.4 bits;  conditional E-value: 9.1e-13
      DUF2154  11 pyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeag 81 
                  + +l+ + i+  +Gd+ + L  a  +++e ++ i+  + dv+i++P+d++v+ +++  f dv++  ek++g
  VIMSS865012 160 SQNLKTVTIDASMGDVSVYLDDAKAAGNEVIMNINTSMCDVNIYIPSDWQVENNMQNNFSDVDIDYEKSTG 230
                  6788999*********************************************************9999887 PP



Or compare VIMSS865012 to CDD or PaperBLAST